Protein Info for QEN71_RS28740 in Paraburkholderia sabiae LMG 24235

Annotation: CidA/LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details PF03788: LrgA" amino acids 38 to 130 (93 residues), 92.9 bits, see alignment E=5e-31

Best Hits

KEGG orthology group: K06518, holin-like protein (inferred from 94% identity to bph:Bphy_2921)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>QEN71_RS28740 CidA/LrgA family protein (Paraburkholderia sabiae LMG 24235)
MISPLIARLAASIRLDATSPVAKIGRIAVQSAAIAGVWFAADYIVRRFGLPVPGGVVGLV
ALLALLFCGGVAPRWVKAGADWLLSDMLLFFIPAAVAAVQYGGLFREDGWRLALVVIAGT
LMVMVAVAFAVEQAARLERRLALRRVMVQRAPVERRAAGRNFL