Protein Info for QEN71_RS28605 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 20 to 207 (188 residues), 86.7 bits, E=2.3e-28
• PF08659: KR
  • amino acids 20 to 127 (108 residues), 26 bits, E=1.2e-09
• PF13561: adh_short_C2
  • amino acids 25 to 260 (236 residues), 105.3 bits, E=5.8e-34

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_2894)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of chorismate metabolism (42/59 steps found)

Protein Sequence (276 amino acids)

>QEN71_RS28605 SDR family oxidoreductase (Paraburkholderia sabiae LMG 24235)
MTVSNDTSAARAQPDRPARTVLVTGAAHRIGRGLAVGFAAAGWNVAVHYGSSKEQADGVV
AEIAALGRRAVALKADLSVEAEVERLVPDCTAALGRPSCIVNNASLFDEDTALDVSYTKL
LHMTSINLGAPLVLARMLHDVTPEEARHDEALRTSVINVLDQKLYNMNPDYLSYTLSKAA
LGTATVALAQALAPKVRVVGLAPGLTLQSGDQTAAAFESAHKVTPLGRASRVEDLVAAAL
YLADARGVTGTTLVVDGGQHLVPLPRDVMFLTGADR