Protein Info for QEN71_RS28330 in Paraburkholderia sabiae LMG 24235

Annotation: transcription termination/antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02357: NusG
  • amino acids 11 to 116 (106 residues), 107.6 bits, E=3.7e-35
• TIGR00922: transcription termination/antitermination factor NusG
  • amino acids 13 to 185 (173 residues), 231 bits, E=3.8e-73
• PF00467: KOW
  • amino acids 134 to 164 (31 residues), 29.9 bits, 3.5e-11

Best Hits

Swiss-Prot: 66% identical to NUSG_NEIMA: Transcription termination/antitermination protein NusG (nusG) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 96% identity to bcj:BCAL0221)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Protein Sequence (185 amino acids)

>QEN71_RS28330 transcription termination/antitermination protein NusG (Paraburkholderia sabiae LMG 24235)
MSDIPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDKFGQILVPTEEVVEVKGGH
KSVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRPSPISPREVEKIMSQMQ
EGVEKPRPKTLFEVGEMVRVKDGPFTDFNGSVEEVNYEKSRVRVSVTIFGRATPVELEFG
QVEKL