Protein Info for QEN71_RS28190 in Paraburkholderia sabiae LMG 24235

Annotation: 50S ribosomal protein L6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03654: ribosomal protein uL6
  • amino acids 2 to 175 (174 residues), 238 bits, E=2.7e-75
• PF00347: Ribosomal_L6
  • amino acids 13 to 81 (69 residues), 47.8 bits, E=9.8e-17
  • amino acids 89 to 163 (75 residues), 88.3 bits, E=2.3e-29

Best Hits

Swiss-Prot: 99% identical to RL6_PARP8: 50S ribosomal protein L6 (rplF) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02933, large subunit ribosomal protein L6 (inferred from 99% identity to bph:Bphy_2824)

MetaCyc: 56% identical to 50S ribosomal subunit protein L6 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L6p (L9e)" in subsystem Ribosome LSU bacterial

Protein Sequence (176 amino acids)

>QEN71_RS28190 50S ribosomal protein L6 (Paraburkholderia sabiae LMG 24235)
MSRVGKSPIALQGAEVALSDERITVKGPLGSISQNANRLVKVVNDNGTLKFEPVDESREA
NAMSGTMRALVANMVHGVTKGFERKLTLVGVGYRAQAQGDKLNLSLGFSHPVVHQMPEGV
KAETPSQTEIVIKGIDKQKVGQVAAEVRGYRPPEPYKGKGVRYANEVVILKETKKK