Protein Info for QEN71_RS28045 in Paraburkholderia sabiae LMG 24235

Annotation: type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 122 to 519 (398 residues), 422.2 bits, see alignment E=1.3e-130 PF07660: STN" amino acids 146 to 193 (48 residues), 34.2 bits, see alignment 2.7e-12 PF03958: Secretin_N" amino acids 219 to 285 (67 residues), 47.1 bits, see alignment E=3.4e-16 PF00263: Secretin" amino acids 364 to 519 (156 residues), 157.8 bits, see alignment E=3e-50

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 88% identity to bph:Bphy_2795)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>QEN71_RS28045 type IV pilus secretin PilQ (Paraburkholderia sabiae LMG 24235)
MTWTATLRWTLVCAAFFTMTARAALPPLPADIPFDDAMTPSGMPPLPRTITTDAANPFTP
DASEDGVAHEVIGPPALAHDEAEPKPQTRTEAQQEALEGPPVPLPPAARLSTSVAASIPA
DRPITLHFQHAELGAVLGAFAKFTGLNIVASEKARGTVTLHLDNVPWRAAFDTLLDVNGL
AMEQRGNVIWVAPLSELAARERQRFETHARAAELEPLASRTFELHYAHAEELRKLLTASG
NQRVLSKRGAAMADARTNLLFVTDLDARLAQIADLIASLDRPTRQVLIEARIVEAEKGFS
RNLGVKLSMTGTNEDGKATGVVGGKDGAILDLSAGPISGFDAATAGLTLFAARATRLLNI
ELSALEADGRGQIVSSPRVVTADRMKAIVEQGTELPYQAKVGQGVSGVQFRRASLKLEVE
PQITPDGRVVLDLDVAKDSVGEQTASGPAINTKHVQTRVEVEDGGTVSIGGIYETDDRDD
VTRVPLLGKIPLLGAFFRHRAHRDLRSELVVFITPRVVQTN