Protein Info for QEN71_RS27840 in Paraburkholderia sabiae LMG 24235

Annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
  • amino acids 3 to 235 (233 residues), 257.9 bits, E=4.5e-81
• PF00977: His_biosynth
  • amino acids 3 to 232 (230 residues), 278.2 bits, E=4.8e-87

Best Hits

Swiss-Prot: 99% identical to HIS4_PARP8: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 99% identity to bph:Bphy_2754)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Protein Sequence (250 amino acids)

>QEN71_RS27840 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase (Paraburkholderia sabiae LMG 24235)
MLLIPAIDLKDGQCVRLKQGDMDQATIFHEEPAVMARHWVDRGARRLHLVDLNGAFAGKP
KNEDAIRAIIEEVGGEIPVQLGGGIRDLNTIERYLDDGLEYVIIGTAAVKNPGFLLEACT
AFGGHIIVGLDAKDGKVATDGWSKLTGHEVVDLARKFEDYGCESIIYTDIGRDGMLQGIN
IEATVRLARSMKIPVIASGGLSNLGDIEALCEVEDEGIEGVICGRAIYSGDLDFAAAQTH
ADRLRESDDA