Protein Info for QEN71_RS27705 in Paraburkholderia sabiae LMG 24235

Annotation: Hsp70 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 376 to 393 (18 residues), see Phobius details PF00012: HSP70" amino acids 6 to 231 (226 residues), 50.1 bits, see alignment E=7.2e-18

Best Hits

KEGG orthology group: K04046, hypothetical chaperone protein (inferred from 94% identity to bph:Bphy_2728)

Predicted SEED Role

"Putative heat shock protein YegD" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>QEN71_RS27705 Hsp70 family protein (Paraburkholderia sabiae LMG 24235)
MTYCAIDFGTSNSAVAVPVGAAASGQATLKLAPVEGAYTTLPTAVFFNTDENSRAYGRAA
LEAYIDGFDGRLMRSMKSILGSALADNTTDLGDGSAIKYTDVIAIFVTHLKRCAEQTAGT
PISRAVLGRPVFFVDDDPRADQLAQQQLEAAARSVGLNEIHFQYEPIAAAFDYEAHLTQE
GLVLVADIGGGTSDFSLVRVGPERMQRIERKDDVLAHHGVHVAGTDFDRRVELVTILREL
GYQSLDPEGREVPNRIYFDLATWHLINTIYTPKRAAELGLMRHLYSDTKHHDRLMRVVEQ
RFGHALAAHAEEAKIGVAAGGETLIDLEIVEEDLRLAFDEAQLVAAGKDETQRIVQAARE
TVQRAGVAPRDVDALYFTGGSTGLAFLSGALAAAFPDAKPVFGDRLASVATGLGIHARRL
FR