Protein Info for QEN71_RS27520 in Paraburkholderia sabiae LMG 24235

Annotation: phenylacetate--CoA ligase PaaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR02155: phenylacetate-CoA ligase" amino acids 11 to 430 (420 residues), 718 bits, see alignment E=1.4e-220 PF00501: AMP-binding" amino acids 82 to 289 (208 residues), 70.1 bits, see alignment E=1.6e-23 PF14535: AMP-binding_C_2" amino acids 335 to 430 (96 residues), 86.1 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 73% identical to PAAK_AZOEV: Phenylacetate-coenzyme A ligase (paaK) from Azoarcus evansii

KEGG orthology group: K01912, phenylacetate-CoA ligase [EC: 6.2.1.30] (inferred from 97% identity to bph:Bphy_2693)

MetaCyc: 73% identical to phenylacetate-CoA ligase (aerobic) (Aromatoleum evansii)
Phenylacetate--CoA ligase. [EC: 6.2.1.30]

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30)" in subsystem Aromatic amino acid interconversions with aryl acids (EC 6.2.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>QEN71_RS27520 phenylacetate--CoA ligase PaaK (Paraburkholderia sabiae LMG 24235)
MTNPLPLDPIEKASRDELAALQLERLKWSLTHAYENSPVYRRKFDEAGVHPSEVKTLSDL
SRFPFTTKKDLRDNYPFGLFAVPQEQISRIHASSGTTGKPTVVGYTARDIDNWANLVARS
IRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDI
IMVTPSYMLSIADELERQGVNPKDCSLRIGIFGAEPWTNDMRRAIEERMGIDAVDIYGLS
EVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIR
YRTRDLTRLLPGTARTMRRMEKITGRSDDMMIIRGVNVFPTQIEELLLKQNALAPHYQIV
LTKEGPLDVMTLNVEPCPETAPDTAALSAAKQALAYDIKALIGVTANVVLLGVNGIERSV
GKARRVIDKRKAGA