Protein Info for QEN71_RS27445 in Paraburkholderia sabiae LMG 24235

Annotation: 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03232: COQ7
  • amino acids 46 to 206 (161 residues), 153.7 bits, E=3.9e-49
• PF02915: Rubrerythrin
  • amino acids 56 to 179 (124 residues), 27.7 bits, E=3.3e-10

Best Hits

Swiss-Prot: 83% identical to COQ7_PARPJ: 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (coq7) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 95% identity to bph:Bphy_2683)

MetaCyc: 51% identical to 5-demethoxyubiquinol hydroxylase (Pseudomonas aeruginosa)
RXN-9243 [EC: 1.14.99.60]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.99.60

Protein Sequence (209 amino acids)

>QEN71_RS27445 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase (Paraburkholderia sabiae LMG 24235)
MLLDELITEFDRGLRSMTGVSRMSRPLPVPPASTEHVELSDEERAHAAGLMRVNHVGEVC
AQALYQAQKLATRSPTLKQAFEHAAREEEDHLAWTYKRLEALESRPSLLNPLWYAGALAI
GFAAGRLGDRVSLGFMAETERQVELHLDGHLTTLPEGDHESRAIVEQMRVDEAAHGKAAT
DAGGIELPFPARALMRAASKIMTRTAYHV