Protein Info for QEN71_RS27430 in Paraburkholderia sabiae LMG 24235

Annotation: cell division protein FtsL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02209: cell division protein FtsL" amino acids 1 to 81 (81 residues), 80.7 bits, see alignment E=3e-27 PF04999: FtsL" amino acids 2 to 76 (75 residues), 62.7 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 84% identical to FTSL_BURPS: Cell division protein FtsL (ftsL) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 97% identity to bph:Bphy_2680)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>QEN71_RS27430 cell division protein FtsL (Paraburkholderia sabiae LMG 24235)
MNRLNIFLLIVVMGCALSVVNATNQQRQFFIQLQRAQSQERQLQQDYSQLQYQQSALSKT
SRIEQLATDSLKMQGATTGRTQYLTLDAGSAKAEDAPIPVSAPNPASATKARGGTR