Protein Info for QEN71_RS27350 in Paraburkholderia sabiae LMG 24235

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 936 PF07517: SecA_DEAD" amino acids 6 to 405 (400 residues), 438.5 bits, see alignment E=3.4e-135 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 827 (800 residues), 1137.7 bits, see alignment E=0 PF00270: DEAD" amino acids 99 to 216 (118 residues), 24.9 bits, see alignment E=4.5e-09 PF01043: SecA_PP_bind" amino acids 232 to 361 (130 residues), 133.9 bits, see alignment E=1.1e-42 PF21090: P-loop_SecA" amino acids 422 to 625 (204 residues), 311.4 bits, see alignment E=7.9e-97 PF07516: SecA_SW" amino acids 627 to 840 (214 residues), 235.4 bits, see alignment E=1.9e-73 PF02810: SEC-C" amino acids 916 to 934 (19 residues), 40 bits, see alignment (E = 8.7e-14)

Best Hits

Swiss-Prot: 90% identical to SECA_BURCJ: Protein translocase subunit SecA (secA) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 90% identity to bch:Bcen2424_0569)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (936 amino acids)

>QEN71_RS27350 preprotein translocase subunit SecA (Paraburkholderia sabiae LMG 24235)
MTTGFLQKIFGSRNQRLVKQYQKTVAAINALEPQIEQLTDDQLRAKTEEFRQRVSSGESL
DKLLPEAFAVCREASKRVLKMRHFDVQLIGGMVLHYGKIAEMRTGEGKTLVATLPVYLNS
LSGRGVHVVTVNDYLAQRDAEWMARLYNFLGLSVGINLSQMDHGLKQEAYAADITYGTNN
EFGFDYLRDNMVYETDARVQRALNFAVVDEVDSILIDEARTPLIISGQAEDHTELYVRMN
ALPPLLERQIGEEKADGTGVEKPGDYTLDEKARQVFLTESGHEKAERLLAEWGLIGEGES
LYAPQNITLMHHVYAALRAHTLFYKDQHYVVQNGEVVIVDEFTGRLMAGRRWSDGLHQAV
EAKEHVKIQSENQTLASITFQNYFRMYAKLSGMTGTADTEAYEFNEIYGLETVVIPTNRP
PKRIDKQDQIYKTALERYNAVIRDIRECYDRGQPVLVGTTSIENSELLSQLLNKAGLPHE
VLNAKQHAREAAIVAEAGRPKRVTIATNMAGRGTDIVLGGNAEKQAAFIEADLSIPEDEK
AGRIQKLHDEWQTLHDQVKAAGGLHIIGTERHESRRIDNQLRGRAGRQGDPGSSRFYLSL
EDPLLRIFAGDRVRAIMDRLKMPEGEAIEAGIVTRSIESAQRKVEARNFDIRKQLLEYDD
VSNDQRKVIYQQRNELLEAHDITETIGAMRHGVITDVVGQFVPAGSIEEQWDVPELEEAL
RNDWQLDLAIQEMINESQQIDANEILEAVTAAADEAYEGKVEQVGRESFSAFERSVMLQT
LDRSWREHLAALDHLRQGIHLRGYAQKNPKQEYKREAFELFAAMLDSVKLEVTRIVMNVQ
IQSPEQLEQAAEQMEEQGSHLENVEFRHADYSEGGAAVAAAPVAANAAAAMIGDAMAHGG
SAAAPLSGDSVPKVGRNDPCPCGSGKKYKQCHGKIA