Protein Info for QEN71_RS27175 in Paraburkholderia sabiae LMG 24235

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF06325: PrmA" amino acids 3 to 296 (294 residues), 330.1 bits, see alignment E=5e-102 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 3 to 290 (288 residues), 247.9 bits, see alignment E=7.4e-78 PF05175: MTS" amino acids 151 to 234 (84 residues), 41.8 bits, see alignment E=3.3e-14 PF01135: PCMT" amino acids 153 to 214 (62 residues), 27.7 bits, see alignment E=7.7e-10 PF13489: Methyltransf_23" amino acids 160 to 277 (118 residues), 48.4 bits, see alignment E=3.1e-16 PF13847: Methyltransf_31" amino acids 165 to 263 (99 residues), 42.9 bits, see alignment E=1.5e-14 PF13649: Methyltransf_25" amino acids 169 to 255 (87 residues), 40.6 bits, see alignment E=1.2e-13 PF08241: Methyltransf_11" amino acids 170 to 257 (88 residues), 34.3 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 97% identical to PRMA_PARP8: Ribosomal protein L11 methyltransferase (prmA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 97% identity to bph:Bphy_2631)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>QEN71_RS27175 50S ribosomal protein L11 methyltransferase (Paraburkholderia sabiae LMG 24235)
MSYRELIVELAREHAEALSDALLELGALSVSVEDADADTPDEQPLFGEPGLTPERTAWTH
SRVIALLAPEHEPAVLLAAAANELGLADTPSFSVREVEEQDWVRLTQSQFDPIPIGERIW
VVPSWHDAPDPNALVLELDPGLAFGTGSHPTTRLCMEWLEQSVQKDQSVLDYGCGSGILA
ILAKKCGANPVIGIDIDPQAVESARHNSERNHADVTYGLPDDCPEGEFDIVVANILSNPL
KLMASMLSSKVKPGGRIALSGILARQAEEVASVYRQWIDIAVWREHEGWVCLAGTRRESN