Protein Info for QEN71_RS26985 in Paraburkholderia sabiae LMG 24235

Annotation: ureidoglycolate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF04115: Ureidogly_lyase" amino acids 1 to 160 (160 residues), 220.8 bits, see alignment E=3.9e-70

Best Hits

Swiss-Prot: 73% identical to ALLA_BURCE: Ureidoglycolate lyase (allA) from Burkholderia cepacia

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 94% identity to bph:Bphy_2594)

MetaCyc: 47% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.19

Use Curated BLAST to search for 3.5.3.19 or 4.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>QEN71_RS26985 ureidoglycolate lyase (Paraburkholderia sabiae LMG 24235)
MNTLRIERLTREAFAPFGDVIELDGARHYPINEGTTERFHDLAKVDVNTQGGRPLINVFR
AQPRAWPIDIVMMERHPLGSQAFVPLSAAPYLIVVAPAGELDPTKLRAFSTHGWQGVNYA
KGVWHHPLLALERVSDFVVVDRGGEGPNCDELALPQTWRLERESFEMLAV