Protein Info for QEN71_RS26910 in Paraburkholderia sabiae LMG 24235

Annotation: GntP family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 53 (23 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 104 to 131 (28 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 428 to 452 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 8 to 451 (444 residues), 539 bits, see alignment E=8.6e-166 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 9 to 452 (444 residues), 494.5 bits, see alignment E=1.5e-152 PF03600: CitMHS" amino acids 25 to 399 (375 residues), 56.2 bits, see alignment E=3.2e-19

Best Hits

Swiss-Prot: 50% identical to GNTP_ZYMMO: Gluconate permease (gntP) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 97% identity to bph:Bphy_2578)

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>QEN71_RS26910 GntP family permease (Paraburkholderia sabiae LMG 24235)
MEAVHGSMLLIYALIAIAVLILMITRFKVYPFLVLIIVSLLLGLAVGMPAGTIVKSFETG
NGNTLGHIAIVVGLGTMLGKMMAESGGAERVATTLINWFGEKNIHWAMMVVAIIVGLPVF
FEVGFVLLIPIAFNVAKRTGKSLLLIGLPMVAGLSVVHGLIPPHPAALLAVQAYHADIGR
TIAYGLIVGVPTAIVAGPLFALLIHRHIKLAANNPLAAQFIDAEERDTKRELPGFGITLF
TILLPVILMLVGSWADLVFAPKTTANDLLKFIGTSDVALLIAVLVSFWTFGAQRGFNREQ
IQKFCGDCLAPIAGITLIVGAGGGFGRVLMDSGISKEIVATATAAHLSPLLFGWFVAALI
RLATGSATVAMTTACGIVAPVAAASGVQVKPELLVLATGSGSLIFSHVNDGGFWLIKEYF
GMTVGQTFKTWSLCETIISLMGLGLTFALAAVL