Protein Info for QEN71_RS26905 in Paraburkholderia sabiae LMG 24235

Annotation: gluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13671: AAA_33
  • amino acids 3 to 135 (133 residues), 39.3 bits, E=8.1e-14
• TIGR01313: carbohydrate kinase, thermoresistant glucokinase family
  • amino acids 4 to 160 (157 residues), 191.2 bits, E=5.3e-61
• PF01202: SKI
  • amino acids 10 to 160 (151 residues), 47.6 bits, E=2.1e-16

Best Hits

Swiss-Prot: 49% identical to GCNK_GLUOX: Gluconokinase (GOX1709) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 93% identity to bph:Bphy_2577)

MetaCyc: 43% identical to D-gluconate kinase, thermostable (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

• ketogluconate metabolism (7/8 steps found)
• D-gluconate degradation (1/1 steps found)
• L-idonate degradation (2/3 steps found)
• sorbitol biosynthesis II (2/3 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Protein Sequence (164 amino acids)

>QEN71_RS26905 gluconokinase (Paraburkholderia sabiae LMG 24235)
MILIAMGVSGAGKTRIGEMLAERLKCTFTDGDAFHSAANKEKMHNGIPLTDEDRWPWLRT
IRAAIEEKQRAGETAVFTCSSLKRSYRDVLRDGDRDVCFVYLKGTQEVLQQRLQTRTGHF
FDPSLLQSQLDTLEEPGEDEAITVSIELTPEQIVDEALAKIEAR