Protein Info for QEN71_RS26625 in Paraburkholderia sabiae LMG 24235

Annotation: LysR substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 3 to 62 (60 residues), 70.1 bits, E=1.2e-23
• PF03466: LysR_substrate
  • amino acids 88 to 301 (214 residues), 155.4 bits, E=1.4e-49

Best Hits

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 100% identity to bph:Bphy_2522)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Protein Sequence (319 amino acids)

>QEN71_RS26625 LysR substrate-binding domain-containing protein (Paraburkholderia sabiae LMG 24235)
MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNVQIFERGTSEVSVTPI
GEQIVTQAQRVLEQTLAIKEIAKQGKDPLVGPLRLGVIYTIGPYLLPTLVKQMIKRVPQM
PLMLQENYTLKLIELLKQGEIDVAIMALPFPETGLMLRPLYDEPFVVALPSGHAWESRNK
IDPGDLKQETMLLLGSGHCFRDHVLGVCPELMRFSQNADGIQKTFEGSSLETIRHMVASG
VGITVLPRMSVHEVKPHAGGVDSGLLSYVPFDDPVPDRRVVLAWRKSFTRMPAIDAICDA
IAACDLPGVKKLDLPAAVN