Protein Info for QEN71_RS26435 in Paraburkholderia sabiae LMG 24235

Annotation: DNA mismatch repair endonuclease MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 TIGR00585: DNA mismatch repair protein MutL" amino acids 36 to 336 (301 residues), 302 bits, see alignment E=3.3e-94 PF02518: HATPase_c" amino acids 55 to 111 (57 residues), 31.8 bits, see alignment 3.4e-11 PF13589: HATPase_c_3" amino acids 58 to 159 (102 residues), 49.1 bits, see alignment E=1.2e-16 PF01119: DNA_mis_repair" amino acids 239 to 355 (117 residues), 133.9 bits, see alignment E=4.5e-43 PF08676: MutL_C" amino acids 503 to 645 (143 residues), 158.9 bits, see alignment E=1.3e-50

Best Hits

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 94% identity to bph:Bphy_2485)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (689 amino acids)

>QEN71_RS26435 DNA mismatch repair endonuclease MutL (Paraburkholderia sabiae LMG 24235)
MSAIPESSEPRADAPAASPDASAAAEGALSPRPLRAIQPLPDQLISQIAAGEVVERPASV
VKELLENALDAGAKTLRILLDEGGVKRISITDDGCGIPESELALALMRHATSKIRSLAEL
EAVATLGFRGEALASIASVSEMHITSRTENVSHATRIDAQTGALSPAAGTRGTTIEVREL
YFNTPARRKFLKSEQTELGHCLEMIRRAALARPDVAISVLHNGRAVEHWNASDPATRVAK
ILGETFATAHLPLDESAGPLAVYGCAGLPTASRGRADQQYFFVNGRFVRDKLLTHAVRAA
YEDVLHGDRYPSYVLFLDLPPEAVDVNVHPSKIEVRFRDSRSIHQFVFHAVQRALARHAG
ASPETTSGGHAARIEPMPSASAGSFASPGTPASFGSTPLGGGFRVSDGGSSQPGNTWMRQ
ARMTQGTLPVAQPLALYDALFGRKDTGAGTSQGTTSLELRDAADTADGAVAPSPFASYAP
SSFGSIAPQSLNPNDEQPLGFALGQIHGIYVLAQNARGLVIVDMHAAHERILYEQFKNAL
ADRAIAVQPLLIPVSMTADAVEIGVVEEERETLDALGFDLAVLSPTSIAIRAVPALLKDA
DLQALARAVLSDLQAYGGSRVLTERQHELLGTLACHHAVRANRRLTLDEMNALLRQMEAT
ERADQCNHGRPTWYQLTLADLDRLFMRGQ