Protein Info for QEN71_RS26295 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF13439: Glyco_transf_4" amino acids 13 to 169 (157 residues), 78.2 bits, see alignment E=2.4e-25 PF13579: Glyco_trans_4_4" amino acids 14 to 164 (151 residues), 54 bits, see alignment E=7.5e-18 PF20706: GT4-conflict" amino acids 55 to 289 (235 residues), 49.9 bits, see alignment E=7.1e-17 PF13477: Glyco_trans_4_2" amino acids 64 to 138 (75 residues), 28.6 bits, see alignment E=4.7e-10 PF00534: Glycos_transf_1" amino acids 181 to 325 (145 residues), 73.3 bits, see alignment E=5.4e-24 PF13692: Glyco_trans_1_4" amino acids 183 to 323 (141 residues), 73.5 bits, see alignment E=6.4e-24

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_2458)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>QEN71_RS26295 glycosyltransferase (Paraburkholderia sabiae LMG 24235)
MRILHLVLEPRLSGAEVLAKDLAIHQQRDGSVVGVTALLPEKPDFAPLTRELESHGVECV
FPAKRSNLPGKLIHLAAVLRRFRPDVLFAHATIPAFYARALPTRVPVVYVMHSAVNDFER
KLFRNVERLLSSRARAVIGVSPANVRDYNDCVGSHPLVTLIPNGVDTSRFTFDDRPCSGD
APPQIVQIGRYTSVKNQLQTVHAFREVATQVPDVRLQLYGVVEDPAYLAAIEDLVKKLGL
EDRVRVDGPHSDVSGVLRASNVFAMPSRSEGHSIAFLEALASGIPVVASTIVPFQFAKTL
PGVQLVDTDETSAYAAALLHALAQPKVPRSLAGLTLQDTAQRYLAVAQQVIGARA