Protein Info for QEN71_RS26265 in Paraburkholderia sabiae LMG 24235

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 19 to 426 (408 residues), 499.9 bits, see alignment E=2.9e-154 PF04052: TolB_N" amino acids 28 to 128 (101 residues), 97.1 bits, see alignment E=1.3e-31 PF07676: PD40" amino acids 192 to 220 (29 residues), 28.9 bits, see alignment (E = 1.7e-10) amino acids 237 to 267 (31 residues), 34.6 bits, see alignment (E = 2.8e-12) amino acids 276 to 311 (36 residues), 51.9 bits, see alignment 1e-17 amino acids 324 to 359 (36 residues), 38.7 bits, see alignment 1.4e-13 amino acids 369 to 396 (28 residues), 13.3 bits, see alignment (E = 1.3e-05)

Best Hits

Swiss-Prot: 99% identical to TOLB_PARP8: Tol-Pal system protein TolB (tolB) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03641, TolB protein (inferred from 99% identity to bph:Bphy_2455)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>QEN71_RS26265 Tol-Pal system beta propeller repeat protein TolB (Paraburkholderia sabiae LMG 24235)
MSLMTKLGLRALVASCLIAAGGAAHAQLNVLVTGVGSTQFPIATANFANEANSPQQISTI
VRQDLQRSGKFTNIDAGSAPVSEGDSVDLGAWKAKGANAFVAGSVTKLPNGQYQVRFKLY
DTVNQQSLGGLELVSPESGLRMSAHKVADYIYAKLMGGRGVFATRLSYVIKTGNRYQLQI
SDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIVYIHDLPTGRRVVVSDQKG
NNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQGSSIDTEPSYSPDGQSIYF
TSDRGGQPQVYKMSASGESSGGAQRVTFTGNYNTSPRVSPDGKQLAYISRTGGGFKLYIQ
DLQSGVATALTDTTHDESPSFAANGQYILYATQVNGRGVLAAVSTDGRTRQVLSVQGGSV
REPSWGPFMQ