Protein Info for QEN71_RS26245 in Paraburkholderia sabiae LMG 24235

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 18 to 142 (125 residues), 172.6 bits, see alignment E=4.1e-55 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 21 to 137 (117 residues), 118.7 bits, see alignment E=1.7e-38 PF13279: 4HBT_2" amino acids 27 to 144 (118 residues), 68.1 bits, see alignment E=9.6e-23 PF03061: 4HBT" amino acids 32 to 116 (85 residues), 66.9 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 46% identical to YBGC_ECOL6: Acyl-CoA thioester hydrolase YbgC (ybgC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 95% identity to bph:Bphy_2451)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>QEN71_RS26245 tol-pal system-associated acyl-CoA thioesterase (Paraburkholderia sabiae LMG 24235)
MRAMNMSDSQSGAEVGGFIWPIRVYYEDTDAGGIVFYANYLKFFERARTEWLRACGVDQR
KLADETGALFVVRSTALDYRAPARLDDMLRIVSRIEKLGRASVDFAQEAWRGDTLLATGT
IRVGCVDSKSMKPAAIPPPVHAALQREPDSNGASMSTAA