Protein Info for QEN71_RS26150 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 246 (235 residues), 76.5 bits, see alignment E=9.5e-26 amino acids 205 to 375 (171 residues), 51.1 bits, see alignment E=5.1e-18

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_2433)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>QEN71_RS26150 MFS transporter (Paraburkholderia sabiae LMG 24235)
MKVVFSRDFLALILSVAVVGLGSGATLPLTALALTQAGYGTDVVGLLTAAQAGGGLLVVP
IAGRIAARCGGRHAIIGAVLIVAIATALMQLTSNPFAWAVLRVMCGAALMLLFTIGEAWV
NQLADDASRGRVVAIYATNFTLFQMAGPVLVSQIAQFDHWRFLICGAIFLIALPVLSVIR
SAPHASDEHEPHGSWRHVLPQMPALVIGTGFFALFDTIALSLMPLFAMAHGVASEVAVLF
ASALLLGDTTMQFPIGWLADRLGRERVHIGCAVLVVLLLPLLPWAVQSPWLCWPLLYVLG
AAAGAIYTLSLVACGERFRGVALVSASSLVGASWSIASFGGPLIAGALMKSVGNDSMIGV
VLVSALAFLAAALWEKRRSVVNAAS