Protein Info for QEN71_RS26035 in Paraburkholderia sabiae LMG 24235

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 146 to 162 (17 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00892: EamA" amino acids 3 to 139 (137 residues), 60.8 bits, see alignment E=8.3e-21 amino acids 150 to 279 (130 residues), 28.4 bits, see alignment E=8.1e-11 TIGR00688: protein RarD" amino acids 4 to 256 (253 residues), 247.6 bits, see alignment E=7e-78

Best Hits

Swiss-Prot: 46% identical to RARD_STREX: Protein RarD (rarD) from Streptomyces exfoliatus

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 96% identity to bph:Bphy_2413)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>QEN71_RS26035 EamA family transporter RarD (Paraburkholderia sabiae LMG 24235)
MNPGVAYALLAFTLWGLFPVYFKSLHQISPVEMLAHRMVWSMLFLFIVLTVRQQWRWLAP
VLRDHRLLGRFAASALLLSTNWGIYIWAVNAGHIVEASLGYFINPLINVLFGLAFLGERL
RRVQWFSVAIAACGVLYLTWQNGHPPWISLALAFSFAGYGLLRKTAQLGALEGLTLETVL
LFPVAVLYLFFASSHGESGFGAATVGVKVLLALAGPITAVPLLLFAAGARRIPLSMLGLI
QYVTPSLQLLIGVLIYREPFGQTQLIGYGAIWVALALYSLEGLWRARFARA