Protein Info for QEN71_RS25805 in Paraburkholderia sabiae LMG 24235

Annotation: rubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to RUBR_ACIAD: Rubredoxin (rubA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 91% identity to cti:RALTA_A0721)

MetaCyc: 57% identical to MTBE monooxygenase rubredoxin component (Methylibium petroleiphilum PM1)
1.14.13.M36 [EC: 1.14.13.M36]

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

methyl tert-butyl ether degradation (3/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (56 amino acids)

>QEN71_RS25805 rubredoxin (Paraburkholderia sabiae LMG 24235)
MEYKSWMCLICGWIYDEEAGLPEEGIAPGTRWEDVPINWTCPECGARKEDFEMVQI