Protein Info for QEN71_RS25600 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 3 to 260 (258 residues), 58.5 bits, E=2.5e-19
• PF01370: Epimerase
  • amino acids 4 to 225 (222 residues), 117.8 bits, E=2.1e-37
• PF01073: 3Beta_HSD
  • amino acids 5 to 252 (248 residues), 67.4 bits, E=4.5e-22
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 308 (303 residues), 62.7 bits, E=1.7e-20
• PF13460: NAD_binding_10
  • amino acids 8 to 172 (165 residues), 41.7 bits, E=4.8e-14
• PF02719: Polysacc_synt_2
  • amino acids 63 to 124 (62 residues), 21.2 bits, E=5.8e-08
• PF07993: NAD_binding_4
  • amino acids 65 to 175 (111 residues), 43.1 bits, E=1.2e-14

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 89% identity to bph:Bphy_2291)

MetaCyc: 50% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Pseudomonas aeruginosa)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-α-D-quinovosamine biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Protein Sequence (318 amino acids)

>QEN71_RS25600 SDR family oxidoreductase (Paraburkholderia sabiae LMG 24235)
MSHVVVSGANGFVGRALCRALLDAGHRVTGLVRRSGGCVDGVTEWIDSSTDYNGIAETWP
AGLAADCIVHLAARVHVMHDTAADPDAAFRATNVDGTLRLAAVAQQHGVPRFLFVSSIKA
VAETDNGRPLREYDAPRIDDAYGRSKRAAEEGLIRLGDATGLEIVIARPPLVYGPQVRAN
FLRLMDAVWRGVPLPLGGADARRSMIYVGNLADALAHCATDPRAVRQCFHVADSTAPTVA
ELVRALARHLGKPARLLPVPASWLRAAGRLTGRSAQVDRLIGGLQVDTSHIRDMLGWQPP
YSTDEGLSATADWYRSTH