Protein Info for QEN71_RS25555 in Paraburkholderia sabiae LMG 24235

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 68 to 100 (33 residues), see Phobius details amino acids 282 to 296 (15 residues), see Phobius details PF00004: AAA" amino acids 193 to 323 (131 residues), 98.7 bits, see alignment E=1.3e-31 amino acids 452 to 573 (122 residues), 78.1 bits, see alignment E=3.1e-25

Best Hits

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (661 amino acids)

>QEN71_RS25555 AAA family ATPase (Paraburkholderia sabiae LMG 24235)
MLEFVVFSLRSFCLGLPLYWGVMLLASLSGHYRLVGAHGFKFMICTVAAACGIVWVNARR
RIWTRVAFGVLSVGMLRLLLAFNVYSLYAVVIWYTGLLLMEFERKRQTRLPGQMQTHPAR
TDLQQPHAPADSSQPDYDYSHLVSRARYGFADIVGMTDTKNRVLAAAKEILSLQDQPDRK
VSGQSRRPPRNGILFFGDPGNGKTLFAEALAGELGLRYISIAYGDIASRWINDTPQRVKA
VFDLARCESPILLFIDELDSFVKDRSSGRSHSMDHDLANVMLTEIVALRGTSVVLVAASN
FIDDSLDRAAIREGRFDYKIEVPPPDFAARKALLARSICRELGQDYIDAETLTTLAQRWE
GFNASRLDALGAQLRDMRANGSLARGRITYDAAMKAMRLLQGRKGKLPEDVKPIDEIIMP
GRSRDMLRDLAFRMKNVHSLERIGGRVPTGLVFAGPPGTGKTQAAMSLARESGYAFLSTT
GEQIIARPESWDALVRQAREIRPTIALVDEGDVILRSRTHSNVSALTNKILTTLDGAEGR
VRDIVYILTTNYLNDIDPAALRGGRFEETIMFDVPDENEMVQYASAQLKRLAGGTYVIMP
GTRMRLSELLVGKSIADANAVLQKTVDAAAVRALRESVNEIRASDVESAAASVFTARTFQ
Q