Protein Info for QEN71_RS25395 in Paraburkholderia sabiae LMG 24235

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 16 to 210 (195 residues), 335.5 bits, E=5.4e-105
• PF02492: cobW
  • amino acids 18 to 188 (171 residues), 137.9 bits, E=1.5e-44

Best Hits

Swiss-Prot: 97% identical to UREG_PARP8: Urease accessory protein UreG (ureG) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03189, urease accessory protein (inferred from 97% identity to bph:Bphy_2263)

MetaCyc: 65% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Protein Sequence (213 amino acids)

>QEN71_RS25395 urease accessory protein UreG (Paraburkholderia sabiae LMG 24235)
MNAPHTMHRTKKLPPLRVGVGGPVGSGKTTLLEMLCKAMRDKYDLVAITNDIYTKEDQRL
LTVAGALPAERIMGVETGGCPHTAIREDASINLEAVDRMLTRFPDADIVFIESGGDNLAA
TFSPELSDLTIYVIDVAGGEKIPRKGGPGITKSDLLVINKTDLAPMVGADLSVMASDAAK
MRGARPFVMCNLKALDGLADVISFIERKGLLVG