Protein Info for QEN71_RS24980 in Paraburkholderia sabiae LMG 24235
Annotation: DUF799 domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to Y1124_NEIMB: Putative lipoprotein NMB1124/NMB1162 (NMB1124) from Neisseria meningitidis serogroup B (strain MC58)
KEGG orthology group: None (inferred from 70% identity to bcn:Bcen_2389)Predicted SEED Role
"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (224 amino acids)
>QEN71_RS24980 DUF799 domain-containing protein (Paraburkholderia sabiae LMG 24235) MTRFFSLKLIAALSVLVSLTACVAHAPRQADYTAFRNSKPKSILVLPPVNNTADVNATYG MLSQMTLPLAEGGYYVVPVVEMEETFKHNGLTTPTDIQNVSPEKLRSIFGADAAVYTKIS QYGSKYMIVDSTTVVSANAKLVDLSSGDTLWSGSASATGKELGTNVNVGGGLIGALVQAA VKQVAHTLSDESHDVAGLTSNRLLSSGGPNGLMYGPRSPKYGTD