Protein Info for QEN71_RS24655 in Paraburkholderia sabiae LMG 24235

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 134 (128 residues), 57.8 bits, see alignment E=6.9e-20 amino acids 148 to 285 (138 residues), 53.2 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_2116)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>QEN71_RS24655 DMT family transporter (Paraburkholderia sabiae LMG 24235)
MKRETQGMLLGLIGVMIFSLTLPMTRIVVAEFSPLLNGLGRALAASVPAAVLLAVRREKL
PTWPQIKSLAVVSLGVIVAFPVFSAWAMKSVPASHGAVVNGLQPLCVAIYAAWLSHERPS
KGFWASAIAGSAIVVAFALQAGGGAFQAGDLLMLVAVGIGALGYAEGARLARQIGGWQVI
CWALVVSAPFLLVPVAWLGWEQHVTHPGPVALKTWLAFGYVTLFSQFVGFFAWYAGLAMG
GTARVGQVQLLQIFFTMAFSALFFGENVTPITWIFAAAVIATVMLGRKAAVHTAVRPVRA
A