Protein Info for QEN71_RS24595 in Paraburkholderia sabiae LMG 24235

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 4 to 314 (311 residues), 459.5 bits, E=3.3e-142
• PF00923: TAL_FSA
  • amino acids 14 to 312 (299 residues), 318.2 bits, E=2.5e-99

Best Hits

Swiss-Prot: 95% identical to TAL_PARP8: Transaldolase (tal) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 95% identity to bph:Bphy_2104)

MetaCyc: 58% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• Bifidobacterium shunt (15/15 steps found)
• Rubisco shunt (10/10 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (317 amino acids)

>QEN71_RS24595 transaldolase (Paraburkholderia sabiae LMG 24235)
MTTALDQLKQYTTVVADTGDFQQLAQYKPQDATTNPSLVLKAVQKDDYKPLLEKTVRDHA
SKPVGAIIDNLLIAFGTEILKIVPGRVSTEVDARLSFDTKASIAKGHELIKMYEAQGIGR
ERVLIKLASTWEGIRAAEVLQKDGIKCNMTLLFSLAQAVAAAEAGAQLISPFVGRIYDWY
KKSAGSNWDEARDGGANDPGVQSVRRIYAYYKKHGFKTEVMGASFRTTSQILELAGCDLL
TISPDLLQKLHDSTDKIERKLSPEASKNADIERVPTDEASFRFLVNDDAMATEKLAEGIR
TFAADAIKLEKVIEGLR