Protein Info for QEN71_RS24100 in Paraburkholderia sabiae LMG 24235

Annotation: NADH-quinone oxidoreductase subunit NuoK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 6 to 101 (96 residues), 101.1 bits, E=1.2e-33

Best Hits

Swiss-Prot: 100% identical to NUOK_PARP8: NADH-quinone oxidoreductase subunit K (nuoK) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 96% identity to bgl:bglu_1g25840)

MetaCyc: 53% identical to ferredoxin-quinone oxidoreductase subunit E (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (101 amino acids)

>QEN71_RS24100 NADH-quinone oxidoreductase subunit NuoK (Paraburkholderia sabiae LMG 24235)
MLSLAHYLVLGAILFAISIVGIFLNRRNVIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ
IFVFFVLTVAAAEAAIGLAILVTLFRSLDTINVEDLDQLKG