Protein Info for QEN71_RS23925 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 3 to 299 (297 residues), 191.5 bits, see alignment E=3.4e-60 PF01370: Epimerase" amino acids 4 to 221 (218 residues), 88.3 bits, see alignment E=1.1e-28 PF16363: GDP_Man_Dehyd" amino acids 40 to 228 (189 residues), 37.6 bits, see alignment E=3.8e-13 PF02719: Polysacc_synt_2" amino acids 42 to 146 (105 residues), 26.7 bits, see alignment E=6.1e-10

Best Hits

Swiss-Prot: 43% identical to MAT2B_XENTR: Methionine adenosyltransferase 2 subunit beta (mat2b) from Xenopus tropicalis

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 86% identity to bph:Bphy_1969)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.133

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>QEN71_RS23925 SDR family oxidoreductase (Paraburkholderia sabiae LMG 24235)
MFKVAVIGASGLLGRAIVGELAQQRDWQLVQTTFSRQSPDSVQLDIRDADAVDRFIERER
PDAIVIAAAERRPDVCENDPALARALNVDAVRAIASAARRHRAWVLSISTDYVFDGTKPP
YRYDAAPSPVNAYGRSKLEGEQALAETTDLGCVLRLPLLFGPIVDWRESAVTSLVPAIAA
SARTSPEAKPAVMDAWAIRYPTYTPDVAIVVRQLLERHARGEAVCGTVQWSGDEPMTKHD
IAKRLANALQIDAQLTPQHTPTDATPRPHNCHLDSSRLEALGIGQRTPFDTAIREVFARF
PWRG