Protein Info for QEN71_RS23865 in Paraburkholderia sabiae LMG 24235

Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10634: Iron_transport
  • amino acids 24 to 175 (152 residues), 228.5 bits, E=2e-72

Best Hits

Swiss-Prot: 69% identical to Y381_BRUSU: UPF0423 protein BRA0381/BS1330_II0378 (BRA0381) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K07230, (no description) (inferred from 94% identity to bph:Bphy_1957)

MetaCyc: 69% identical to ferrous iron uptake system, iron-binding protein FtrA (Brucella abortus 2308)

Predicted SEED Role

"Periplasmic protein p19 involved in high-affinity Fe2+ transport" in subsystem Campylobacter Iron Metabolism or Transport of Iron

Protein Sequence (182 amino acids)

>QEN71_RS23865 iron transporter (Paraburkholderia sabiae LMG 24235)
MRVSSILSGGVAALAAVAVMSASAAEYPIGKQQIQGGMEIGAVYLQPITMDPEGMMRKAS
DSDVHLEADIHAVKKNPTGFAEGDWMPYLQVRYELTKPGSSYDQKGDLMAMVADDGPHYG
DNVKLAGPGKYHLKLIVEPPMQTGHMAFGRHVDKETGVGPWFKPFTLEYDFTFAGIGKKG
GY