Protein Info for QEN71_RS23600 in Paraburkholderia sabiae LMG 24235

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00126: HTH_1" amino acids 7 to 66 (60 residues), 73.8 bits, see alignment E=8.3e-25 PF03466: LysR_substrate" amino acids 91 to 295 (205 residues), 176 bits, see alignment E=6.8e-56

Best Hits

Swiss-Prot: 38% identical to RBCR_ACIFR: RuBisCO operon transcriptional regulator (rbcR) from Acidithiobacillus ferrooxidans

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_1827)

Predicted SEED Role

"Cys regulon transcriptional activator CysB" in subsystem Cysteine Biosynthesis or DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>QEN71_RS23600 LysR family transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MLKAATFRQLKALHTVAKLGSVSGAAEELRLTQPAVSLQIRLLEEAAGAPLLQRVGRGVQ
LTAAGEILARYALEILDLWNGAADDLAALHGEQGGTLRIGAITTAEYLIPPFLVRFTEAR
PQVKVQFKVGNRADIIRMLATHEIDLAVMGSPPRELRTVATVFAKHPMAFVASPSHALMK
RKRLTLGDLESANLFVRERGSGTRSTVENLFRQAGHKIHIGSELSSNEAIKQLVEAGLGI
SFLSLHACTLEFHAGLLALLPLPDNPIERDWYVMHVSDKRLPHVASLFRDFLIEEGMKGS
VPIPMPSVAALKKRRRV