Protein Info for QEN71_RS23545 in Paraburkholderia sabiae LMG 24235

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 409 to 438 (30 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 46 to 429 (384 residues), 240.5 bits, see alignment E=1.3e-75

Best Hits

Swiss-Prot: 72% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 97% identity to bph:Bphy_1821)

MetaCyc: 72% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Xanthine/uracil permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>QEN71_RS23545 NCS2 family permease (Paraburkholderia sabiae LMG 24235)
MMEPQAQSIAEAGSEAFDDTRNGQTASNAAFIDRFFDITARGSTGRQEIVAGITTFLAMV
YSVFVVPGMFGKAGFDTSAVFVAVCLTTAFGSLLMGIWARLPIAIGCAISLTAFTAFGLV
LGKGLQPNVALGAVFLMGLVFTAISVTGVRSWILRNLPAGVAHGTGIGIGLFLLLIAAND
VGLVVKNPGPGLPVSLGHITSLPVLMSVGGLAAIFGLVRRRVPGSILIVIVAISALALLL
DPAVAFHGVFALPSLSAPGHASLIGAMDIKGALSLAVLPSVLALVMTAVFDATGTIRAVA
GQAGQLDENGRIINGGRALTADSLSSIFSGFMGGAPAAAYIESTVGVAAGAKTGLAAAVV
GLLFLVVMFFSPLAALVPSYATAPALMYVGLLMLSSVSKLHMDDMVDSMSGLVCAVFIVL
TANIVTGIMLGFCTLVIGRVVSGEWRKLNVGTVAIAVVLAVFYLGGWAI