Protein Info for QEN71_RS23090 in Paraburkholderia sabiae LMG 24235

Annotation: tRNA pseudouridine(55) synthase TruB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 15 to 222 (208 residues), 269.6 bits, see alignment E=9.3e-85 PF01509: TruB_N" amino acids 36 to 183 (148 residues), 194.6 bits, see alignment E=1.8e-61 PF16198: TruB_C_2" amino acids 184 to 241 (58 residues), 60.5 bits, see alignment E=2.1e-20 PF09157: TruB-C_2" amino acids 245 to 307 (63 residues), 53.5 bits, see alignment E=2.8e-18

Best Hits

Swiss-Prot: 78% identical to TRUB_BURMA: tRNA pseudouridine synthase B (truB) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 91% identity to bph:Bphy_1727)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>QEN71_RS23090 tRNA pseudouridine(55) synthase TruB (Paraburkholderia sabiae LMG 24235)
MTQNQRPKVPRRALDGVLLLDKPVGLSSNDALIRAKRLYLAKKAGHTGTLDPLASGLLPL
CFGEATKFSQDLLEADKTYEATMRLGIRTTTGDAEGEAIDTRDVTCDERAVEQALAQFRG
DIVQVPPMYSALKRDGKPLYEYARAGQTVEREGRRVTIHVLEMIACALPDVTFRVTCSKG
TYVRTLAEDIGEALGCGAHLVMLRRTGVGALTLANSVTLNALSDAQPSERDGWLQPVDAL
LSTFPSVQLDEDATRRFLHGQRLRLADLSVDQDALQAAVRARVYGSEGKLLGVARASEGV
LAPERLIVS