Protein Info for QEN71_RS23050 in Paraburkholderia sabiae LMG 24235

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 4 to 476 (473 residues), 574.7 bits, E=6.9e-177
• PF03486: HI0933_like
  • amino acids 5 to 47 (43 residues), 25.9 bits, 2.4e-09
• PF07992: Pyr_redox_2
  • amino acids 5 to 338 (334 residues), 264.5 bits, E=7.9e-82
• PF12831: FAD_oxidored
  • amino acids 6 to 53 (48 residues), 29 bits, 4.4e-10
• PF01134: GIDA
  • amino acids 6 to 156 (151 residues), 25.4 bits, E=4.4e-09
• PF00890: FAD_binding_2
  • amino acids 6 to 43 (38 residues), 28.5 bits, 5.6e-10
• PF13738: Pyr_redox_3
  • amino acids 141 to 322 (182 residues), 36.7 bits, E=1.7e-12
• PF00070: Pyr_redox
  • amino acids 186 to 261 (76 residues), 65 bits, E=4.5e-21
• PF02737: 3HCDH_N
  • amino acids 186 to 251 (66 residues), 22.5 bits, E=5.8e-08
• PF02852: Pyr_redox_dim
  • amino acids 357 to 466 (110 residues), 129.7 bits, E=3.4e-41

Best Hits

Swiss-Prot: 77% identical to DLDH_CUPNH: Dihydrolipoyl dehydrogenase (odhL) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 99% identity to bph:Bphy_1719)

MetaCyc: 49% identical to dihydrolipoyl dehydrogenase subunit (Syntrophotalea carbinolica DSM 2380)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (476 amino acids)

>QEN71_RS23050 dihydrolipoyl dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKAL
LASSEEFENASHHLADHGISVENVKVDIAKMLARKEGIVEKMTKGIEFLFRKNKITWLKG
HGKFTGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARHLPNVPVDNKIVADNEGALSF
TEVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPEFLGAADQALAKEAAKQFKKQGL
DIHVGVKVGEVKTTDNSVSISYTDKDGNAKTLDADRLIVSIGRVPNTDNLGLEAIGLKAN
ERGFIDVDDHCATSVPNVYAIGDVVRGPMLAHKAEDEGVLVAEIIDGQKPHIDYNCVPWV
IYTEPEIAWVGKTEQQLKAEGREIKSGQFPFMANGRALGINKADGFVKMIADAKTDELLG
VHIISANASDLIAEAVVAMEFKAASEDLGRICHPHPSLSEVMREAALAVDKRALNM