Protein Info for QEN71_RS22975 in Paraburkholderia sabiae LMG 24235

Annotation: AMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 60 to 454 (395 residues), 316.7 bits, E=1.9e-98
• PF13193: AMP-binding_C
  • amino acids 505 to 579 (75 residues), 69.6 bits, E=3.5e-23

Best Hits

Swiss-Prot: 54% identical to LCFA_HAEIN: Long-chain-fatty-acid--CoA ligase (fadD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 95% identity to bph:Bphy_1704)

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate β-oxidation (28/35 steps found)
• fatty acid salvage (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• long-chain fatty acid activation (1/1 steps found)
• 2-deoxy-D-ribose degradation II (6/8 steps found)
• phytol degradation (3/4 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• octane oxidation (3/5 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• capsaicin biosynthesis (3/7 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Protein Sequence (596 amino acids)

>QEN71_RS22975 AMP-binding protein (Paraburkholderia sabiae LMG 24235)
MTEPTTSHSAMQTQTQTQTQAQPPTQRAPNTDGIWYASYAPEVPREIDTSQYASVVAFFD
ECTTRFRERVAYVSVGESLTYGELARKATAFAAYLQSIGVKPGDRVAIMLPNTFQYPVAL
FGVLKTGAIVVNVNPLYTVRELSHQLKDSGAQTIVVFENFAKTVEDSLPGTRVQNVVVTG
LGDLLKEGLNFKGKLINFILRHVKKLVPAYNLPQAVPLLDALATGYKRTLSPVPISPADL
AFLQYTGGTTGVAKGAMLTHRNIVANLLQAKVWAESQLTDEIETVLTPLPLYHIYSLTVN
AMIFMGLGGRNILIANPRDTKMVMKILRNETFTGITAVNTLYNAFLDNEEFRQRDFSKLK
LAMAGGMAMQKAVADRFREVTGKPIIEGYGLTECSPIVSMNPVDLKHMREFDGSIGLPAP
STQVRFRKDDGSWANIGEPGELCVQGPQVMKGYWNRPEETAKVLDDDGWLATGDIGVMDS
RGYIRLIDRKKDMILVSGFNVYPNEIEDVIAMHPDVREVAAIGIPDVAQGERVKVFVVRR
NPSLTEEQVIAHCRKNLTGYKVPKVVEFRDELPQTNVGKILRRELRDQELAKQKNP