Protein Info for QEN71_RS22900 in Paraburkholderia sabiae LMG 24235

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details PF13727: CoA_binding_3" amino acids 54 to 127 (74 residues), 38.8 bits, see alignment E=1e-13 PF02397: Bac_transf" amino acids 159 to 349 (191 residues), 218.2 bits, see alignment E=6.3e-69

Best Hits

KEGG orthology group: None (inferred from 82% identity to bph:Bphy_1691)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>QEN71_RS22900 sugar transferase (Paraburkholderia sabiae LMG 24235)
MSELVQRTIDIALIVLGAFGARHLNLNVLQIGPPHALDPTLVAFVAALALSVFPACGTYP
PRGSRSVASIAGRTTFAWLAVQLCGLALLYAIHRDHLISLPWFIYWTLTTGISLLASHTL
FFAEHSVSRQVAAWLRREDAAPDLPDVEAHPRTIRHVVKRAFDVVASLMFIVALSPLLVV
LALVVKSDGGPAFYGHTRVGRNGEKFRCLKFRSMVVNSEQVLKDLLANDPAARAEWEREF
KLRHDVRVTGIGHFLRRTSLDELPQLWNVVRGEMSLVGPRPIIAQELERYGVNSKYYLMA
TPGITGLWQVSGRCETDYATRVQLDVKYVKNWSLRSDIGILFKTFFVVIRGNGAY