Protein Info for QEN71_RS22855 in Paraburkholderia sabiae LMG 24235

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 246 to 273 (28 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 417 to 445 (29 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 87% identity to bph:Bphy_1679)

Predicted SEED Role

"FIG00993547: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>QEN71_RS22855 hypothetical protein (Paraburkholderia sabiae LMG 24235)
MPSIYGIIVILIGLLVLYTSFRGAIYAMAAFSLFACTQALGLGSIGIMPAQLFLVFFALR
AFNLSGGKGITDAFAMDKAGFWLLCTTVWGVAGAVILPRLLQGSTLVFPVDRGITGAAML
QPLGPVSGNLSQAIYCVGDLVVYACMVAFLKYRGAYRALASGIFLLTCLDVAAGVIDFVT
HAAGLDVMSVIKTASYADLSGEELGGLVRITGTFAETSAFSSFTLPLFVFCLNLWLLGYR
PKMAGLLAIATGTLLLMSTSGTAYVGLAAYMGVQMISRPGRVSPGAVERQQRMWIIAACA
GVLGTLYVILFMPGVAKALADFVDTTVMSKADSSSGIERMSWNTQGVTNFLDTYGIGVGL
GSIRASSFVVVVLANLGAVGVVCYGMFLAKTLLSPVSTHYPPTERAVCHAARHGMIATLI
VASLAAGVFELGSTFYMFAAAAGALSQRAPRRVPRSREWVTQHVHEGVPDSR