Protein Info for QEN71_RS22585 in Paraburkholderia sabiae LMG 24235

Annotation: sulfate ABC transporter permease subunit CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 3 to 270 (268 residues), 324.8 bits, see alignment E=4.5e-101 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 12 to 274 (263 residues), 424.1 bits, see alignment E=2.4e-131 PF00528: BPD_transp_1" amino acids 78 to 277 (200 residues), 85.9 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 50% identical to CYST_ECOLI: Sulfate transport system permease protein CysT (cysU) from Escherichia coli (strain K12)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 97% identity to bph:Bphy_1628)

MetaCyc: 50% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>QEN71_RS22585 sulfate ABC transporter permease subunit CysT (Paraburkholderia sabiae LMG 24235)
MTTLTFRKPSAIPGFGLTLGITVAYLSLVVLIPLAATFLKTATLDWSQFVRAVSSPRVLA
SYRLTFFSALGGALINALFGFLVAWVLVRYRFPFKRIVDAVVDLPFALPTSVAGISLAAI
YSGNGWIGQFLEPLGIKIAFTPVGVLVALTFIGLPFVVRTVQPVLEEFEREQEEAAACLG
ASRWLTFRRVVLPAVFPALLTGFALAFARALGEYGSVIFIAGNVPMKSEITSLLIITKLE
QYDYAGATALAVVMLVVSFLMLLLINTLQWYLQRRTSRGRTAPTVAPSTTVVAGGAQ