Protein Info for QEN71_RS22430 in Paraburkholderia sabiae LMG 24235

Annotation: DegT/DnrJ/EryC1/StrS aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 15 to 374 (360 residues), 371.7 bits, E=2.2e-115

Best Hits

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_0926)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Protein Sequence (383 amino acids)

>QEN71_RS22430 DegT/DnrJ/EryC1/StrS aminotransferase family protein (Paraburkholderia sabiae LMG 24235)
MTQSSVPFLPFVRPEIDEETISGVVDVLRSGWITTGPQNQAFEKALSEYCGGRPVRTFNS
GTATLEIGLRIAGVGAGDEVITTPASWVATSNVILEVGATPVFVDIDPVTRNIDLDLMEK
AITPRTKAIIPVFLSGLPVDMDRLYAIARAHKLRVIEDAAQAFGATWNGERIGKLGDIVS
FSFHANKNLTSIEGGALVLNNEEEAILAQKYRLQGITRTGFDGMDCDLLGGKYNLTDVAA
RVGLGQLQHIERFRTQRHKLARAYFTGFEGGAAVKLGMGLPLADFENTNWHMFLITLPLA
RLSISRAGFMEQMKERGIGTGMHYPAIHLFSLYRAMGYKEGMYPHAEHYGATTVTLPLFT
LMNEGDVERVCRAVNETCEQYGQ