Protein Info for QEN71_RS22395 in Paraburkholderia sabiae LMG 24235

Annotation: molybdopterin molybdotransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 305 to 318 (14 residues), see Phobius details PF03453: MoeA_N" amino acids 3 to 162 (160 residues), 154.7 bits, see alignment E=2.6e-49 TIGR00177: molybdenum cofactor synthesis domain" amino acids 172 to 317 (146 residues), 90.6 bits, see alignment E=4.8e-30 PF00994: MoCF_biosynth" amino acids 175 to 320 (146 residues), 113.1 bits, see alignment E=1.4e-36 PF03454: MoeA_C" amino acids 341 to 401 (61 residues), 37.5 bits, see alignment E=3.5e-13

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 93% identity to bph:Bphy_0933)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>QEN71_RS22395 molybdopterin molybdotransferase MoeA (Paraburkholderia sabiae LMG 24235)
MLSTADALATLLGAAVQIDGTETLSTLDATNRVLATDVVSPLDVPPMNTSSMDGYAVRVA
ELSQGERRLPISQRIPAGHAPQPLAEGTAARIFTGATVPPGADAIVMQEQTEAAGDEVTI
LHTPKAGEWITQQGADIHKGATILPAGTRLSPQALGLVASVGCANLEVVRRVKVAVFFTG
DELTMPGEPLAPGAIYNSNRFTLTGLLHKLGCEVTDYGIVPDKLDATRNTLREAAQAHDL
ILTCGGVSVGEEDHVKPAVEAEGRLSMWQIAMKPGKPLAFGAIRRAEDQDNSGETFFIGL
PGNPVSTFVTFLLFVRPFLLRLAGVRTVTPRALSLRADFTQHKGDRRNEFLRARVNAAGG
LDLFPNQSSAVLTSTVWGDGLIDNPPNHTISAGETVRFIPFSELLN