Protein Info for QEN71_RS22285 in Paraburkholderia sabiae LMG 24235

Annotation: recombination mediator RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00615: recombination protein RecR" amino acids 2 to 196 (195 residues), 232.4 bits, see alignment E=1.6e-73 PF21176: RecR_HhH" amino acids 8 to 48 (41 residues), 73.7 bits, see alignment 2e-24 PF02132: RecR_ZnF" amino acids 55 to 74 (20 residues), 27.2 bits, see alignment (E = 6.7e-10) PF13662: Toprim_4" amino acids 82 to 171 (90 residues), 91.1 bits, see alignment E=1.1e-29 PF01751: Toprim" amino acids 82 to 162 (81 residues), 35.2 bits, see alignment E=2.8e-12 PF21175: RecR_C" amino acids 173 to 196 (24 residues), 46.8 bits, see alignment (E = 4.2e-16)

Best Hits

Swiss-Prot: 98% identical to RECR_PARP8: Recombination protein RecR (recR) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K06187, recombination protein RecR (inferred from 98% identity to bph:Bphy_0953)

MetaCyc: 50% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>QEN71_RS22285 recombination mediator RecR (Paraburkholderia sabiae LMG 24235)
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDRDGAEKLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDTERDPTLLCVVETPADQIMLEQTMTWRGLYFVLMGRLSPLDGIGPK
EIHFDRLVKRATDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLSVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM