Protein Info for QEN71_RS22225 in Paraburkholderia sabiae LMG 24235

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF05958: tRNA_U5-meth_tr" amino acids 251 to 433 (183 residues), 63.1 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 87% identical to RLMD_BURCM: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 98% identity to bph:Bphy_0965)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>QEN71_RS22225 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Paraburkholderia sabiae LMG 24235)
MEARGVGRTVTEDGSPGKVIFVEGALPGERVTYSSYRKKPSFEQAQVVDILKESVIRTRP
QCKFFGTCGGCSMQHLDERAQIAVKGRVLEDNLMHLAKLRPETVFRPIHGPTWGYRYRAR
LTVRHVAKKGGVLVGFHERKSSYVADMTSCEVLPPHVSDMLVPLRHMVEALSIRDRMPQI
ELAVGASVTALVLRILEPINAADEQLLRDFADQHNVQFWLQPKGPDTVYPFYPLDKPLDY
SLPEFNIRMPFRPTDFTQVNHQINRVLVGRALRLLAPAKTDRVLDLFCGIGNFTLPLARI
SREVVGIEGSEVLTSRALDNAKENGVDSHTSFACRNLFEVTADDIRALGHFDKYLIDPPR
EGALAVSKALADIAQSGEGPLPKRIVYVSCNPATLARDAGLLVHEAGYRLKGAGVVNMFP
HTSHVESIALFERD