Protein Info for QEN71_RS22200 in Paraburkholderia sabiae LMG 24235

Annotation: acetyl-CoA C-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00108: Thiolase_N
  • amino acids 4 to 262 (259 residues), 364.6 bits, E=4.2e-113
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 6 to 391 (386 residues), 505.2 bits, E=5.9e-156
• PF00109: ketoacyl-synt
  • amino acids 80 to 118 (39 residues), 22.2 bits, 1.5e-08
• PF02803: Thiolase_C
  • amino acids 270 to 392 (123 residues), 188.9 bits, E=3.3e-60

Best Hits

Swiss-Prot: 86% identical to THIL_CUPNH: Acetyl-CoA acetyltransferase (phaA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 97% identity to bph:Bphy_0970)

MetaCyc: 86% identical to acetyl-CoA acetyltransferase subunit (Cupriavidus necator)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16, 2.3.1.9]

Predicted SEED Role

"3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)" (EC 2.3.1.16, EC 2.3.1.9)

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• acetyl-CoA fermentation to butanoate (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• ketolysis (3/3 steps found)
• polyhydroxybutanoate biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• acetoacetate degradation (to acetyl CoA) (2/2 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• ketogenesis (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• 2-deoxy-D-ribose degradation II (6/8 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• L-isoleucine degradation I (4/6 steps found)
• propanoate fermentation to 2-methylbutanoate (4/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to acetone (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• ethylmalonyl-CoA pathway (6/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• 4-ethylphenol degradation (anaerobic) (2/6 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• ethylbenzene degradation (anaerobic) (1/5 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• L-lysine fermentation to acetate and butanoate (4/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• 2-methylpropene degradation (2/8 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
• mevalonate pathway II (haloarchaea) (1/7 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• isoprene biosynthesis II (engineered) (1/8 steps found)
• mevalonate pathway III (Thermoplasma) (1/8 steps found)
• mevalonate pathway IV (archaea) (1/8 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• jasmonic acid biosynthesis (5/19 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• sitosterol degradation to androstenedione (1/18 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of ergosterol biosynthesis I (5/26 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
• superpathway of L-lysine degradation (12/43 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
• superpathway of cholesterol biosynthesis (5/38 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Ethylbenzene degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.9

Use Curated BLAST to search for 2.3.1.16 or 2.3.1.9

Protein Sequence (393 amino acids)

>QEN71_RS22200 acetyl-CoA C-acetyltransferase (Paraburkholderia sabiae LMG 24235)
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERSGVKPEQVSEVIMGQVLAAG
SGQNPARQSLIKAGLPMAVPGMTINKVCGSGLKAVMLAANAIIAGDADIVIAGGQENMSA
APHVLPGSRDGFRMGDAKLIDTMIVDGLWDVYNQYHMGVTAENVAKEYGITREDQDAFAA
LSQNKAEAAQKSGRFNDEIVPIQIPQKKGDPLSFATDEFVRHGVTAESLAGLKPAFSKEG
TVTAANASGLNDGAAAVVVMSAKKAEALGLTPLARIKAYANAGVDPKVMGMGPVPASRRC
LERAGWSVNDLDLMEINEAFAAQALAVHKQMGWDTSKINVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALALERP