Protein Info for QEN71_RS22165 in Paraburkholderia sabiae LMG 24235

Annotation: cystathionine beta-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF01053: Cys_Met_Meta_PP" amino acids 12 to 390 (379 residues), 301.9 bits, see alignment E=2.6e-94 TIGR01324: cystathionine beta-lyase" amino acids 26 to 392 (367 residues), 405.4 bits, see alignment E=9.4e-126

Best Hits

Swiss-Prot: 37% identical to METC_BORAV: Cystathionine beta-lyase (metC) from Bordetella avium

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 94% identity to bph:Bphy_0977)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>QEN71_RS22165 cystathionine beta-lyase (Paraburkholderia sabiae LMG 24235)
MTQKTPKHGLQTRIVQPDDQITHGWESFSVPVARASTVVFPDLAAMRALDWKNDAQWRYG
LHATPTSIALAQRLAALEGGSHALLQPSGLSSISNVYFGFVKSGDDVLLPDNVYSPNRDH
AEWLAKDFGITARYYDPMIGAGIADLIQPNTKLIWLEAPGSVTMEVSDIPAITAVARARG
VVTAIDNTWSAGLAFRPFEHGVDISMQALTKYQSGGSDVLMGATITVDKELHLKLKMARM
RMGIGVSSDDCSLILRSLPSMKVRFEQHTKSALELARWLKTRPEIAAVLHPALSDCPGHE
FYQRDFTGAGGLFSVVFDARYTPEQIDTFCESLDLFSLGWSWGGAQSLVMPYNVASMRTE
SQWPHRGTLVRFYVGLEDEGDLRKDIERCLVALG