Protein Info for QEN71_RS21995 in Paraburkholderia sabiae LMG 24235

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR00045: glycerate kinase" amino acids 10 to 376 (367 residues), 327.9 bits, see alignment E=4.3e-102 PF02595: Gly_kinase" amino acids 10 to 376 (367 residues), 391.1 bits, see alignment E=2.5e-121

Best Hits

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 95% identity to bph:Bphy_1009)

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>QEN71_RS21995 glycerate kinase (Paraburkholderia sabiae LMG 24235)
MPNTSSAPIVVIAPDSFKGSLSAEEVAQSIASGILRARSDATIRICAMADGGEGTLDAML
TRGGERRMLTVRGAAGAAREAAMGLLADGSAIIETAEVVGITDPVGMGVPVEKRSTRGMG
EAIRSLLDAGVRRFFVALGGSSTNDGGAGLLVGLGLKLFDAQGHELDATPEQLAQLARVD
ASALDTRLREATFVGMSDVDNPLTGDHGATAIFGPQKGVQPAQVATIDAALAHFADLVEP
AMNRVARNQPGAGAAGGLGFALHMLGADFEPGAEVVAREVGLDAALEGANWLITGEGRSD
VQTLHGKAPFIACRHARAASVPATLLSGAVDPSALPKLAEYFSGCFSPAPGPITLEVAIR
DAATLLANEAEQMTRLRYGPR