Protein Info for QEN71_RS21945 in Paraburkholderia sabiae LMG 24235

Annotation: arylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00657: Lipase_GDSL
  • amino acids 57 to 224 (168 residues), 70.8 bits, E=1.9e-23
• PF13472: Lipase_GDSL_2
  • amino acids 59 to 217 (159 residues), 95.5 bits, E=5.8e-31

Best Hits

KEGG orthology group: K10804, acyl-CoA thioesterase I [EC: 3.1.1.5 3.1.2.-] (inferred from 93% identity to bph:Bphy_1017)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

MetaCyc Pathways

• phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5, 3.1.2.-

Use Curated BLAST to search for 3.1.1.2 or 3.1.1.5 or 3.1.2.-

Protein Sequence (239 amino acids)

>QEN71_RS21945 arylesterase (Paraburkholderia sabiae LMG 24235)
MVKRRLKVRAVASIAALTAACFPFVFAATFSEPALAASNSNATNTAGSNAQQSKPTIVVL
GDSLSAEYGLPRDTGWVSLMRQRLSSAQIDYNVANASISGDTTSGGRARLPALMQRLKPA
IVIVELGANDALRGVPLSTTEDNLRTIVEQAQQGHAKVLLVGMYVPPNYGPDYTQKFHEL
YGQLSKQLRVPLVPFLLAGIENKPDMFQSDQIHPTQRAQPLLLDNVWPALKPLLHTSSQ