Protein Info for QEN71_RS21655 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 PF13439: Glyco_transf_4" amino acids 97 to 237 (141 residues), 30.5 bits, see alignment E=1.1e-10 amino acids 453 to 620 (168 residues), 43.1 bits, see alignment E=1.5e-14 PF00534: Glycos_transf_1" amino acids 244 to 396 (153 residues), 82.1 bits, see alignment E=1.1e-26 amino acids 635 to 800 (166 residues), 113.7 bits, see alignment E=2.1e-36 PF13692: Glyco_trans_1_4" amino acids 250 to 382 (133 residues), 68.7 bits, see alignment E=2e-22 amino acids 648 to 787 (140 residues), 89.2 bits, see alignment E=9.6e-29 PF13579: Glyco_trans_4_4" amino acids 454 to 618 (165 residues), 40.2 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: K00754, [EC: 2.4.1.-] (inferred from 92% identity to bph:Bphy_1074)

Predicted SEED Role

"Glycosyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (831 amino acids)

>QEN71_RS21655 glycosyltransferase family 4 protein (Paraburkholderia sabiae LMG 24235)
MNHDIVEEDLLRPTPVTRDAGHDLIPTTPVSRPPATPVKRRGARSVGPVRVAIIHDWLVT
YAGAERVLEQIVACFPDADLFSLVDFLDDRTFLRGKSVTTSFIQKLPMARTKYRSYLPLM
PLAIEQLDVSAYDVVISSSHAVAKGVLTGPDQVHISYVHSPIRYAWDLQHQYLQQSKLTS
GPKSAFARLILHYMRNWDIRTSNSVDAFVANSEFISRRIRKVYQRESEVIFPPVDVEAFS
LCEQKDDFYLTASRMVPYKKIDLIVEAFAKMPERKLVVIGDGPDMQKVREKATPNVQIMG
YQPFNVLRDHMRRAKAFVFAAEEDFGISVVEVQACGTPVIAYGKGGALETVRDQYESHPT
GIFFNEQTTDSIIDAVEHFASDPARFRPADCRANAERFSIRHFRERFFGFVRESVPALRG
ASLPSDDPPVIGKEQKHETSALRVLAIDQSGVMGGAELSLLEIVKALKARVQVVLFDDGP
FRVALHREGVAVDVLDPGAIREVRKQGGTPPLAKAVKGVASLVRATVARARDSDVIYANT
QRAMVIGAIAGRLARRPVVWHLRDIVSPEHFGGKQLAIIKWCAKLGLAHVIANSAASARA
FSDLTQFGDKRIDVVFNGISSAPFNALRDVPQSVLRARLNLPQDAFLVGSFSRLAQWKGQ
HVLLEAMVLNPHMHAVLVGAALFGEDAYEAKLHEFVATHGLEERVHFLGFQDDVAACMCA
VDVVAHTSITPEPFGRVIVEGMLAQRPVVASRAGGVTEIIDDGVNGVMCTPGDAHALADT
LAELRSDQALRDRLVARGYQTAVRKFGTQTYVEGVERILANVAGAHAKIAS