Protein Info for QEN71_RS21535 in Paraburkholderia sabiae LMG 24235

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 131 to 168 (38 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details TIGR00688: protein RarD" amino acids 14 to 262 (249 residues), 149 bits, see alignment E=9e-48 PF00892: EamA" amino acids 15 to 143 (129 residues), 38.3 bits, see alignment E=7.1e-14

Best Hits

KEGG orthology group: None (inferred from 91% identity to rcu:RCOM_1801460)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>QEN71_RS21535 EamA family transporter RarD (Paraburkholderia sabiae LMG 24235)
MNANNQKQKEGAGYAALLVALCWWGLMPLYYWHLKEVSAPEMLAHRVFWSFALLSVVIAL
KPALRQQMGDWRSFALALLPAVLLSANWVVYILASVTGNALQASLGYFLNPLLSAALGIV
FLNERLNGLKALALALGVAGTAVQCVAHGGVPVFALMLTVTFSLLGLTRKVWPTRNAILS
TWRETVVMMPFALGYFGYLTSHHALAFTSYGIDASVLMMLAGPLTVVPLALYAYAMPLVS
LTESAVMQYVTPTVTFVLALTVFHERLTAIDLTGYGLIWCGLALATYASVRRRRLTLVAA
PTPAAGSATQGVQSVQGVQGAGVAGQNVSFLAAHKKTPASAGVNRFWHSEGRPEPERRCE
KSDA